DYNC1LI1 Peptide - C-terminal region
DYNC1LI1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DNCLI1, FLJ10219
UniProt
Q9Y6G9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DYNC1LI1 Rabbit Polyclonal Antibody (orb326557) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057225
Preservative
Lyophilized powder
AA Sequence
AEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
357917-01 48 Tests
Pc (Pyruvate carboxylase, mitochondrial) BioAssayTM ELISA Kit (Rat) discontinued
Sign In for Pricing
View Details 357917-02 96 Tests
Pc (Pyruvate carboxylase, mitochondrial) BioAssayTM ELISA Kit (Rat) discontinued
Sign In for Pricing
View Details 
MBS1403936 Inquire
Recombinant Xanthomonas campestris pv. campestris Elongation factor 4 (lepA), partial
Sign In for Pricing
View Details 
TL310169V 500 µL Each
Prolactin Receptor (PRLR) Human shRNA Lentiviral Particle (Locus ID 5618)
Sign In for Pricing
View Details 