Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC1LI1 Peptide - C-terminal region

DYNC1LI1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DNCLI1, FLJ10219

UniProt

Q9Y6G9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYNC1LI1 Rabbit Polyclonal Antibody (orb326557) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057225

Preservative

Lyophilized powder

AA Sequence

AEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human WDR43 Protein
E30P03176A 50 µg

Recombinant Human WDR43 Protein

Sign In for Pricing
View Details
Rhinovirus Outer Capsid Protein 3 (VP3, Rhinovirus VP3) discontinued. see R2010-07
227329 1 mg

Rhinovirus Outer Capsid Protein 3 (VP3, Rhinovirus VP3) discontinued. see R2010-07

Sign In for Pricing
View Details
M tuberculosis CFP10 Antibody
OAMA02208-1MG 1 mg

M tuberculosis CFP10 Antibody

Sign In for Pricing
View Details
MTND4P21 Protein Vector (Human) (pPM-C-HA)
31010021 500 ng

MTND4P21 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rpl14 (NM_025974) Mouse Recombinant Protein
E45M48189M5 20 µg

Rpl14 (NM_025974) Mouse Recombinant Protein

Sign In for Pricing
View Details
Anti-PARP6 antibody
STJ192118 200 µl

Anti-PARP6 antibody

Sign In for Pricing
View Details