FLOT1 Peptide - C-terminal region
FLOT1 Peptide - C-terminal region
Product Specifications
UniProt
O75955
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FLOT1 Rabbit Polyclonal Antibody (orb586350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005794
Preservative
Lyophilized powder
AA Sequence
QQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLER
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC401609 20 µg
EVI1 (MECOM) (NM_005241) Human Over-expression Lysate
Sign In for Pricing
View Details ![Carboxypeptidase M (CPM) Mouse Monoclonal Antibody [Clone ID: OTI7C1]](https://cdn.genprice.uk/products/937/68dd18b9061270361e908049/imageurl/cf807285.webp)
CF807285 100 µg
Carboxypeptidase M (CPM) Mouse Monoclonal Antibody [Clone ID: OTI7C1]
Sign In for Pricing
View Details 
22502-AAT 200 Tests
Live or Dead™ Fixable Dead Cell Staining Kit *Orange Fluorescence with 405 nm Excitation*
Sign In for Pricing
View Details 