Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLOT1 Peptide - C-terminal region

FLOT1 Peptide - C-terminal region

Product Specifications

UniProt

O75955

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLOT1 Rabbit Polyclonal Antibody (orb586350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005794

Preservative

Lyophilized powder

AA Sequence

QQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNG2 Rabbit Polyclonal Antibody
TA374199 100 µL

CACNG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Storage Box
R1020-O 5 Units/Pack

Storage Box

Sign In for Pricing
View Details
MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF594 conjugate, 0.1mg/mL
BNC941101-500 1x 500 µL

MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HINT2 Mouse Monoclonal Antibody [Clone ID: AT5B10]
AM50638PU-N 100 µL

HINT2 Mouse Monoclonal Antibody [Clone ID: AT5B10]

Sign In for Pricing
View Details
Integrin Linked Kinase (ILK) Rabbit Polyclonal Antibody
AP21113PU-N 100 µg

Integrin Linked Kinase (ILK) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Skin
CS700935 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details