Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR22 Peptide - C-terminal region

GPR22 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC129847

UniProt

Q99680

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR22 Rabbit Polyclonal Antibody (orb586352) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005286

Preservative

Lyophilized powder

AA Sequence

YTKILQALNIRIGTRFSTGQKKKARKKKTISLTTQHEATDMSQSSGGRNV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Srl Mouse Gene Knockout Kit (CRISPR)
KN516715 1 Kit

Srl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EFCAB1 (NM_001142857) Human Over-expression Lysate
LC428290 20 µg

EFCAB1 (NM_001142857) Human Over-expression Lysate

Sign In for Pricing
View Details
6-ROX glycine *25 uM fluorescence reference solution for PCR reactions*
395-AAT 5 mL

6-ROX glycine *25 uM fluorescence reference solution for PCR reactions*

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), Biotin conjugate, 0.1mg/mL
BNCB0979-500 1x 500 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Lens culinaris Lectin (Lentil) -LcH-,  30nm
GP-1401-30 1 mL

Colloidal Gold Conjugated Lens culinaris Lectin (Lentil) -LcH-, 30nm

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR561874 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details