Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR22 Peptide - C-terminal region

GPR22 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC129847

UniProt

Q99680

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR22 Rabbit Polyclonal Antibody (orb586352) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005286

Preservative

Lyophilized powder

AA Sequence

YTKILQALNIRIGTRFSTGQKKKARKKKTISLTTQHEATDMSQSSGGRNV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-(6-Aminohexyl)-N'-(4-chlorophenyl)imidodicarbonimidic Diamide Dihydrochloride
TRC-A610050-250MG 250 mg

N-(6-Aminohexyl)-N'-(4-chlorophenyl)imidodicarbonimidic Diamide Dihydrochloride

Sign In for Pricing
View Details
SPCS3 (C-term) Rabbit Polyclonal Antibody
AP17761PU-N 400 µL

SPCS3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/3298), CF740 conjugate, 0.1mg/mL
BNC743298-100 1x 100 µL

TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/3298), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM162A (C-term) Rabbit Polyclonal Antibody
AP51495PU-N 400 µL

FAM162A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MS4A10 Human Gene Knockout Kit (CRISPR)
KN219671 1 Kit

MS4A10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human YWHAH-AS1 activation kit by CRISPRa
GA108528 1 Kit

Human YWHAH-AS1 activation kit by CRISPRa

Sign In for Pricing
View Details