Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR22 Peptide - C-terminal region

GPR22 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC129847

UniProt

Q99680

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR22 Rabbit Polyclonal Antibody (orb586353) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005286

Preservative

Lyophilized powder

AA Sequence

KVLKSKMKKRVVSIVEADPLPNNAVIHNSWIDPKRNKKITFEDSEIREKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tomatidine Hydrochloride, >85%
TRC-T538500-50MG 50 mg

Tomatidine Hydrochloride, >85%

Sign In for Pricing
View Details
Human Plexin A4 (PLXNA4) activation kit by CRISPRa
GA114127 1 Kit

Human Plexin A4 (PLXNA4) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS704756 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), CF405S conjugate, 0.1mg/mL
BNC041951-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (CIP1/2489R), CF594 conjugate, 0.1mg/mL
BNC942489-100 1x 100 µL

P21WAF1 (Tumor Suppressor Protein) (CIP1/2489R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NMDAR2B (Ab-1336) Antibody
8B8257-AAT 50 µg

NMDAR2B (Ab-1336) Antibody

Sign In for Pricing
View Details