Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR22 Peptide - C-terminal region

GPR22 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC129847

UniProt

Q99680

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR22 Rabbit Polyclonal Antibody (orb586353) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005286

Preservative

Lyophilized powder

AA Sequence

KVLKSKMKKRVVSIVEADPLPNNAVIHNSWIDPKRNKKITFEDSEIREKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant BHMT Antibody
RC-16124-01 50 μL

Recombinant BHMT Antibody

Sign In for Pricing
View Details
Recombinant BHMT Antibody
RC-16124-02 100 µL

Recombinant BHMT Antibody

Sign In for Pricing
View Details
Recombinant BHMT Antibody
RC-16124-03 1 mL

Recombinant BHMT Antibody

Sign In for Pricing
View Details
Diethylene Glycol Monopentyl Ether
TRC-D446313-1G 1 g

Diethylene Glycol Monopentyl Ether

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS706938 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
Gastrin (GAST/2632), CF405S conjugate, 0.1mg/mL
BNC042632-100 1x 100 µL

Gastrin (GAST/2632), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details