Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR78 Peptide - C-terminal region

GPR78 Peptide - C-terminal region

Product Specifications

UniProt

Q96P69

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR78 Rabbit Polyclonal Antibody (orb586355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_543009

Preservative

Lyophilized powder

AA Sequence

ILSKCLTYSKAVADPFTYSLLRRPFRQVLAGMVHRLLKRTPRPASTHDSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSNARE1 Antibody (FITC)
abx313639-01 20 µg

TSNARE1 Antibody (FITC)

Sign In for Pricing
View Details
TSNARE1 Antibody (FITC)
abx313639-02 50 µg

TSNARE1 Antibody (FITC)

Sign In for Pricing
View Details
TSNARE1 Antibody (FITC)
abx313639-03 100 µg

TSNARE1 Antibody (FITC)

Sign In for Pricing
View Details
TSNARE1 Antibody (FITC)
abx313639-04 200 µg

TSNARE1 Antibody (FITC)

Sign In for Pricing
View Details
TSNARE1 Antibody (FITC)
abx313639-05 1 mg

TSNARE1 Antibody (FITC)

Sign In for Pricing
View Details
BAHD1 Human qPCR Primer Pair (NM_014952)
HP211281 200 Reactions

BAHD1 Human qPCR Primer Pair (NM_014952)

Sign In for Pricing
View Details