Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR78 Peptide - C-terminal region

GPR78 Peptide - C-terminal region

Product Specifications

UniProt

Q96P69

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR78 Rabbit Polyclonal Antibody (orb586355) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_543009

Preservative

Lyophilized powder

AA Sequence

ILSKCLTYSKAVADPFTYSLLRRPFRQVLAGMVHRLLKRTPRPASTHDSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy5.5 Alkyne
CA2200 1 mg

Cy5.5 Alkyne

Sign In for Pricing
View Details
Chicken Butyrophilin like protein 2 (BTNL2) ELISA kit
GTR10401940 96 Well

Chicken Butyrophilin like protein 2 (BTNL2) ELISA kit

Sign In for Pricing
View Details
DHRS7B Rabbit Polyclonal Antibody (PE)
orb494591 100 µL

DHRS7B Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Phospho-AP2M1 (Thr156) Recombinant Rabbit mAb
E43S43162 100 µL

Phospho-AP2M1 (Thr156) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Rice Os01g0847700 protein
MBS8576997-01 0.1 mL

Rice Os01g0847700 protein

Sign In for Pricing
View Details
Rice Os01g0847700 protein
MBS8576997-02 0.1 mL (AF405L)

Rice Os01g0847700 protein

Sign In for Pricing
View Details