Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO8 Peptide - C-terminal region

IPO8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ26580, RANBP8

UniProt

O15397

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IPO8 Rabbit Polyclonal Antibody (orb331323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001177924

Preservative

Lyophilized powder

AA Sequence

PPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEENEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP1B1 3'UTR GFP Stable Cell Line
TU050901 1.0 mL

AP1B1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CA5A (NM_001739) Human Recombinant Protein
PROTP35218 20 µg

CA5A (NM_001739) Human Recombinant Protein

Sign In for Pricing
View Details
Hamartin Antibody
KC-2281-01 50 μL

Hamartin Antibody

Sign In for Pricing
View Details
Hamartin Antibody
KC-2281-02 100 µL

Hamartin Antibody

Sign In for Pricing
View Details
Hamartin Antibody
KC-2281-03 1 mL

Hamartin Antibody

Sign In for Pricing
View Details
Recombinant Bacillus halodurans UPF0059 membrane protein BH3770 (BH3770), partial
MBS7099795 Inquire

Recombinant Bacillus halodurans UPF0059 membrane protein BH3770 (BH3770), partial

Sign In for Pricing
View Details