Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO8 Peptide - C-terminal region

IPO8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ26580, RANBP8

UniProt

O15397

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IPO8 Rabbit Polyclonal Antibody (orb331323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001177924

Preservative

Lyophilized powder

AA Sequence

PPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEENEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAS2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
21317064 1.0 µg DNA

GAS2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Pde6h sgRNA CRISPR Lentivector set (Rat)
K7088101 3x 1.0 µg

Pde6h sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Human TADG14 Protein ELISA Kit
955668 96 Tests

Human TADG14 Protein ELISA Kit

Sign In for Pricing
View Details
Rabbit Gamma-Aminobutyric Acid Receptor Subunit Alpha-5 (GABRA5) ELISA Kit
MBS9941012 Inquire

Rabbit Gamma-Aminobutyric Acid Receptor Subunit Alpha-5 (GABRA5) ELISA Kit

Sign In for Pricing
View Details
ZNF10 (Zinc Finger Protein 10, Zinc Finger Protein KOX1, KOX1) (MaxLight 750) discontinued
135588-ML750 100 µL

ZNF10 (Zinc Finger Protein 10, Zinc Finger Protein KOX1, KOX1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Prohibitin-2 (phb2)
orb2927165-01 20 µg

Recombinant Schizosaccharomyces pombe Prohibitin-2 (phb2)

Sign In for Pricing
View Details