Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL5A Peptide - C-terminal region

KIR2DL5A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD158F, KIR2DL5, KIR2DL5.1, KIR2DL5.3

UniProt

Q8N109

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIR2DL5A Rabbit Polyclonal Antibody (orb326558) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065396

Preservative

Lyophilized powder

AA Sequence

QLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Adenosine A1 Receptor ELISA Kit
MBS105311-01 48 Well

Sheep Adenosine A1 Receptor ELISA Kit

Sign In for Pricing
View Details
Sheep Adenosine A1 Receptor ELISA Kit
MBS105311-02 96 Well

Sheep Adenosine A1 Receptor ELISA Kit

Sign In for Pricing
View Details
Sheep Adenosine A1 Receptor ELISA Kit
MBS105311-03 5x 96 Well

Sheep Adenosine A1 Receptor ELISA Kit

Sign In for Pricing
View Details
Sheep Adenosine A1 Receptor ELISA Kit
MBS105311-04 10x 96 Well

Sheep Adenosine A1 Receptor ELISA Kit

Sign In for Pricing
View Details
Rabdoternin A
orb1985371-01 100 mg

Rabdoternin A

Sign In for Pricing
View Details
Rabdoternin A
orb1985371-02 500 mg

Rabdoternin A

Sign In for Pricing
View Details