Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL5A Peptide - C-terminal region

KIR2DL5A Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD158F, KIR2DL5, KIR2DL5.1, KIR2DL5.3

UniProt

Q8N109

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIR2DL5A Rabbit Polyclonal Antibody (orb326558) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065396

Preservative

Lyophilized powder

AA Sequence

QLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rgc32 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6975803 1.0 µg DNA

Rgc32 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Ces2a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3202607 1.0 µg DNA

Ces2a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal MEPCE Antibody
NBP3-29769 100 µg

Rabbit Polyclonal MEPCE Antibody

Sign In for Pricing
View Details
2-Methylheptane
OR1043722-01 5 g

2-Methylheptane

Sign In for Pricing
View Details
2-Methylheptane
OR1043722-02 25 g

2-Methylheptane

Sign In for Pricing
View Details
Prolactin, Human (Luteotropic Hormone, PRL) discontinued
215095 100 µg

Prolactin, Human (Luteotropic Hormone, PRL) discontinued

Sign In for Pricing
View Details