Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KTI12 Peptide - C-terminal region

KTI12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC20419, RP11-91A18.3, SBBI81, TOT4

UniProt

Q96EK9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KTI12 Rabbit Polyclonal Antibody (orb586359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612426

Preservative

Lyophilized powder

AA Sequence

GAAESPALVTPDSEKSAKHGSGAFYSPELLEALTLRFEAPDSRNRWDRPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,5,7-Trimethyladamantane-1-carboxylic acid
FT123101-01 0.5 g

3,5,7-Trimethyladamantane-1-carboxylic acid

Sign In for Pricing
View Details
3,5,7-Trimethyladamantane-1-carboxylic acid
FT123101-02 1 g

3,5,7-Trimethyladamantane-1-carboxylic acid

Sign In for Pricing
View Details
3,5,7-Trimethyladamantane-1-carboxylic acid
FT123101-03 2 g

3,5,7-Trimethyladamantane-1-carboxylic acid

Sign In for Pricing
View Details
3,5,7-Trimethyladamantane-1-carboxylic acid
FT123101-04 5 g

3,5,7-Trimethyladamantane-1-carboxylic acid

Sign In for Pricing
View Details
Recombinant Shigella Flexneri rpsE Protein (aa 2-167)
VAng-Lsx08122-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Flexneri rpsE Protein (aa 2-167)

Sign In for Pricing
View Details
MAU2 (MAU2 Chromatid Cohesion Factor Homolog, MAU2 Chromatid Cohesion Factor Homolog (C. Elegans) )
485488 100 µL

MAU2 (MAU2 Chromatid Cohesion Factor Homolog, MAU2 Chromatid Cohesion Factor Homolog (C. Elegans) )

Sign In for Pricing
View Details