Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KTI12 Peptide - C-terminal region

KTI12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC20419, RP11-91A18.3, SBBI81, TOT4

UniProt

Q96EK9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KTI12 Rabbit Polyclonal Antibody (orb586359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612426

Preservative

Lyophilized powder

AA Sequence

GAAESPALVTPDSEKSAKHGSGAFYSPELLEALTLRFEAPDSRNRWDRPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rac1 Recombinant Protein (Human)
RP025603 100 µg

Rac1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Human AIFM2 shRNA Plasmid
abx963662-01 150 µg

Human AIFM2 shRNA Plasmid

Sign In for Pricing
View Details
Human AIFM2 shRNA Plasmid
abx963662-02 300 µg

Human AIFM2 shRNA Plasmid

Sign In for Pricing
View Details
JMT Antibody
orb791447 2 mg

JMT Antibody

Sign In for Pricing
View Details
Mouse AP-1 Complex Subunit Gamma-1 (AP1G1) ELISA Kit
abx501987 96 Tests

Mouse AP-1 Complex Subunit Gamma-1 (AP1G1) ELISA Kit

Sign In for Pricing
View Details
Zfp260 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4586605 3x 1.0 µg

Zfp260 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details