Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MON2 Peptide - C-terminal region

MON2 Peptide - C-terminal region

Product Specifications

UniProt

Q6P148

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MON2 Rabbit Polyclonal Antibody (orb586365) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAH65289

Preservative

Lyophilized powder

AA Sequence

SVAFHCLLDLVRGITSMIEGELGELETECQTTTEEGSSPTQSTEQQDLQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRC Polyclonal Antibody, APC Conjugated
bs-1135R-APC-TR 20 µL

SRC Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
2- (2'-N-Boc-hydrazino) benzoic acid
413317-01 100 mg

2- (2'-N-Boc-hydrazino) benzoic acid

Sign In for Pricing
View Details
2- (2'-N-Boc-hydrazino) benzoic acid
413317-02 250 mg

2- (2'-N-Boc-hydrazino) benzoic acid

Sign In for Pricing
View Details
Anti-ALDH3A1 Antibody Picoband® Fluoro647 Conjugated
A01121-4-Fluoro647 100 µg/Vial

Anti-ALDH3A1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
LOC365238 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
27166156 3x 1.0 µg DNA

LOC365238 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Comfort MTP (HxD) 11x7=77 plates 35mm, 408x630x135mm
TE35346 1 Piece

Comfort MTP (HxD) 11x7=77 plates 35mm, 408x630x135mm

Sign In for Pricing
View Details