Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MON2 Peptide - C-terminal region

MON2 Peptide - C-terminal region

Product Specifications

UniProt

Q6P148

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MON2 Rabbit Polyclonal Antibody (orb586365) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAH65289

Preservative

Lyophilized powder

AA Sequence

SVAFHCLLDLVRGITSMIEGELGELETECQTTTEEGSSPTQSTEQQDLQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBPSUHL (RBPJL) (NM_014276) Human Over-expression Lysate
LC415401 20 µg

RBPSUHL (RBPJL) (NM_014276) Human Over-expression Lysate

Sign In for Pricing
View Details
COMMD6 Polyclonal Antibody
A65854-020 20 µL

COMMD6 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Interleukin 23 (IL23) ELISA Kit
orb1665462-01 48 Tests

Mouse Interleukin 23 (IL23) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 23 (IL23) ELISA Kit
orb1665462-02 96 Tests

Mouse Interleukin 23 (IL23) ELISA Kit

Sign In for Pricing
View Details
Human Rabies virus IgG antibody (RV-IgG-Ab) ELISA Kit
SLY4286Hu-01 96 Tests

Human Rabies virus IgG antibody (RV-IgG-Ab) ELISA Kit

Sign In for Pricing
View Details
Human Rabies virus IgG antibody (RV-IgG-Ab) ELISA Kit
SLY4286Hu-02 48 Tests

Human Rabies virus IgG antibody (RV-IgG-Ab) ELISA Kit

Sign In for Pricing
View Details