POLDIP2 Peptide - C-terminal region
POLDIP2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DKFZp586F1524, PDIP38, POLD4
UniProt
Q9Y2S7
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POLDIP2 Rabbit Polyclonal Antibody (orb586370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_056399
Preservative
Lyophilized powder
AA Sequence
SSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEKTPPSGLH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681556-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC043779-500 1x 500 µL
MUC5AC (Mucin 5AC / Gastric Mucin) (rMUC5AC/3779), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472074-100 1x 100 µL
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 