Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1CB Peptide - C-terminal region

PPP1CB Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC3672, PP-1B, PP1beta, PPP1CD

UniProt

P62140

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP1CB Rabbit Polyclonal Antibody (orb586371) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002700

Preservative

Lyophilized powder

AA Sequence

LFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIPF (Gastric Triacylglycerol Lipase, GL, Gastric Lipase, MGC138477, MGC142271) APC
MBS6137412-01 0.1 mL

LIPF (Gastric Triacylglycerol Lipase, GL, Gastric Lipase, MGC138477, MGC142271) APC

Sign In for Pricing
View Details
LIPF (Gastric Triacylglycerol Lipase, GL, Gastric Lipase, MGC138477, MGC142271) APC
MBS6137412-02 5x 0.1 mL

LIPF (Gastric Triacylglycerol Lipase, GL, Gastric Lipase, MGC138477, MGC142271) APC

Sign In for Pricing
View Details
TBX18 (T-Box 18) (HRP)
252425-HRP 100 µL

TBX18 (T-Box 18) (HRP)

Sign In for Pricing
View Details
SLTM Double Nickase Plasmid (h)
sc-413251-NIC 20 µg

SLTM Double Nickase Plasmid (h)

Sign In for Pricing
View Details
CD209 Recombinant Protein (Human)
RP037897 100 µg

CD209 Recombinant Protein (Human)

Sign In for Pricing
View Details
Recombinant Rhodopseudomonas palustris Urease subunit beta (ureB)
MBS1324295-01 0.02 mg (E-Coli)

Recombinant Rhodopseudomonas palustris Urease subunit beta (ureB)

Sign In for Pricing
View Details