PPP1CB Peptide - C-terminal region
PPP1CB Peptide - C-terminal region
Product Specifications
Product Name Alternative
MGC3672, PP-1B, PP1beta, PPP1CD
UniProt
P62140
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP1CB Rabbit Polyclonal Antibody (orb586371) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002700
Preservative
Lyophilized powder
AA Sequence
LFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS4381682-01 0.02 mg (With BSA & Azide at 0.2mg/mL)
TPO (Thyroid Peroxidase) (Thyroid Marker)
Sign In for Pricing
View Details MBS4381682-02 0.1 mg (With BSA & Azide at 0.2mg/mL)
TPO (Thyroid Peroxidase) (Thyroid Marker)
Sign In for Pricing
View Details MBS4381682-03 0.1 mg (Without BSA & Azide at 1mg/mL)
TPO (Thyroid Peroxidase) (Thyroid Marker)
Sign In for Pricing
View Details MBS4381682-04 5x 0.1 mg (With BSA & Azide at 0.2mg/mL)
TPO (Thyroid Peroxidase) (Thyroid Marker)
Sign In for Pricing
View Details MBS4381682-05 5x 0.1 mg (Without BSA & Azide at 1mg/mL)
TPO (Thyroid Peroxidase) (Thyroid Marker)
Sign In for Pricing
View Details 
589223 96 Tests
Double C2 Like Domains Beta (DOC2b) BioAssayTM ELISA Kit (Human)
Sign In for Pricing
View Details