STXBP4 Peptide - N-terminal region
STXBP4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ16496, MGC149829, MGC50337, Synip
UniProt
Q6ZWJ1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with STXBP4 Rabbit Polyclonal Antibody (orb331327) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_848604
Preservative
Lyophilized powder
AA Sequence
SVNKESMIGVSFEEAKSIITGAKLRLESAWEIAFIRQKSDNIQPENLSCT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740204-100 1x 100 µL
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 