Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VCY Peptide - N-terminal region

VCY Peptide - N-terminal region

Product Specifications

Product Name Alternative

BPY1, MGC119817, VCY1, VCY1A, VCY1B

UniProt

O14598

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VCY Rabbit Polyclonal Antibody (orb326562) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004670

Preservative

Lyophilized powder

AA Sequence

PPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Endothelin Converting Enzyme 1 (ECE1) ELISA Kit
RDR-ECE1-Hu-01 96 Tests

Human Endothelin Converting Enzyme 1 (ECE1) ELISA Kit

Sign In for Pricing
View Details
Human Endothelin Converting Enzyme 1 (ECE1) ELISA Kit
RDR-ECE1-Hu-02 48 Tests

Human Endothelin Converting Enzyme 1 (ECE1) ELISA Kit

Sign In for Pricing
View Details
SalI, 1000U
RV1326 1000 U

SalI, 1000U

Sign In for Pricing
View Details
BANF2 (NM_001014977) Human Over-expression Lysate
LY423098 100 µg

BANF2 (NM_001014977) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Plexin-A1 Antibody
RC-15766-01 50 μL

Recombinant Plexin-A1 Antibody

Sign In for Pricing
View Details
Recombinant Plexin-A1 Antibody
RC-15766-02 100 µL

Recombinant Plexin-A1 Antibody

Sign In for Pricing
View Details