Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VCY Peptide - N-terminal region

VCY Peptide - N-terminal region

Product Specifications

Product Name Alternative

BPY1, MGC119817, VCY1, VCY1A, VCY1B

UniProt

O14598

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VCY Rabbit Polyclonal Antibody (orb326562) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004670

Preservative

Lyophilized powder

AA Sequence

PPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS702702 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
CD81 / TAPA-1 (C81/2885R), CF640R conjugate, 0.1mg/mL
BNC402885-100 1x 100 µL

CD81 / TAPA-1 (C81/2885R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MDH1 Rabbit Polyclonal Antibody
TA378416 100 µL

MDH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Asialoglycoprotein Receptor 1 (ASGR1) Human Gene Knockout Kit (CRISPR)
KN205686 1 Kit

Asialoglycoprotein Receptor 1 (ASGR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TBC1D2 Human Gene Knockout Kit (CRISPR)
KN423443 1 Kit

TBC1D2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR561425 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details