Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD6 Peptide - C-terminal region

ABHD6 Peptide - C-terminal region

Product Specifications

UniProt

Q9BV23

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABHD6 Rabbit Polyclonal Antibody (orb331328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065727

Preservative

Lyophilized powder

AA Sequence

MLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TKTL1 (NM_001145933) Human Over-expression Lysate
LC431505 20 µg

TKTL1 (NM_001145933) Human Over-expression Lysate

Sign In for Pricing
View Details
N-AcetyIglucosamine Gel Immobilized Carbohydrates
CG-003-5 5 mL

N-AcetyIglucosamine Gel Immobilized Carbohydrates

Sign In for Pricing
View Details
Mono(4-hydroxypentyl)phthalate
TRC-M547550-100MG 100 mg

Mono(4-hydroxypentyl)phthalate

Sign In for Pricing
View Details
Alkyl DHAP synthase (AGPS) (NM_003659) Human Over-expression Lysate
LY401211 100 µg

Alkyl DHAP synthase (AGPS) (NM_003659) Human Over-expression Lysate

Sign In for Pricing
View Details
CRISP2 (NM_001142407) Human Over-expression Lysate
LY428074 100 µg

CRISP2 (NM_001142407) Human Over-expression Lysate

Sign In for Pricing
View Details
GDF 5 (GDF5) (NM_000557) Human Over-expression Lysate
LY424647 100 µg

GDF 5 (GDF5) (NM_000557) Human Over-expression Lysate

Sign In for Pricing
View Details