Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD6 Peptide - C-terminal region

ABHD6 Peptide - C-terminal region

Product Specifications

UniProt

Q9BV23

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABHD6 Rabbit Polyclonal Antibody (orb331328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065727

Preservative

Lyophilized powder

AA Sequence

MLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRP2 Antibody
KC-34926-01 50 μL

MRP2 Antibody

Sign In for Pricing
View Details
MRP2 Antibody
KC-34926-02 100 µL

MRP2 Antibody

Sign In for Pricing
View Details
MRP2 Antibody
KC-34926-03 1 mL

MRP2 Antibody

Sign In for Pricing
View Details
Recombinant DENV (type 2, strain New Guinea C) NS1 Protein (His Tag)
PKSV030124 100 µg

Recombinant DENV (type 2, strain New Guinea C) NS1 Protein (His Tag)

Sign In for Pricing
View Details
HABP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8D6]
TA809299BM 100 µL

HABP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8D6]

Sign In for Pricing
View Details
Scp2 Mouse Gene Knockout Kit (CRISPR)
KN515398 1 Kit

Scp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details