Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL9A1 Peptide - N-terminal region

COL9A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DJ149L1.1.2, EDM6, FLJ40263, MED, STL4

UniProt

A6NEQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL9A1 Rabbit Polyclonal Antibody (orb333730) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_511040

Preservative

Lyophilized powder

AA Sequence

GADGLTGPDGSPGSIGSKGQKGEPGVPGSRGFPGRGIPGPPGPPGTAGLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDA Antibody
KC-211-01 50 μL

CDA Antibody

Sign In for Pricing
View Details
CDA Antibody
KC-211-02 100 µL

CDA Antibody

Sign In for Pricing
View Details
CDA Antibody
KC-211-03 1 mL

CDA Antibody

Sign In for Pricing
View Details
UBA52 (NM_003333) Human Recombinant Protein
TP311036L 1 mg

UBA52 (NM_003333) Human Recombinant Protein

Sign In for Pricing
View Details
CASQ2 (NM_001232) Human Over-expression Lysate
LC400493 20 µg

CASQ2 (NM_001232) Human Over-expression Lysate

Sign In for Pricing
View Details
TRAF6 Polyclonal Antibody
E-AB-18251-01 20 µL

TRAF6 Polyclonal Antibody

Sign In for Pricing
View Details