Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL9A1 Peptide - N-terminal region

COL9A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DJ149L1.1.2, EDM6, FLJ40263, MED, STL4

UniProt

A6NEQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL9A1 Rabbit Polyclonal Antibody (orb333730) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_511040

Preservative

Lyophilized powder

AA Sequence

GADGLTGPDGSPGSIGSKGQKGEPGVPGSRGFPGRGIPGPPGPPGTAGLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-L-,  15nm
GP-1801-15 1 mL

Colloidal Gold Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-L-, 15nm

Sign In for Pricing
View Details
CAMK2G Rabbit Polyclonal Antibody
TA374232 100 µL

CAMK2G Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Atxn10 Mouse Gene Knockout Kit (CRISPR)
KN501850 1 Kit

Atxn10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Catalase Microplate Assay Kit
RDSM061 100 Assays

Catalase Microplate Assay Kit

Sign In for Pricing
View Details
Lofentanil Oxalate
TRC-L469370-1MG 1 mg

Lofentanil Oxalate

Sign In for Pricing
View Details
Chromogranin A (CGA/414), CF594 conjugate, 0.1mg/mL
BNC940414-500 1x 500 µL

Chromogranin A (CGA/414), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details