CA7 Peptide - middle region
CA7 Peptide - middle region
Product Specifications
Product Name Alternative
CAVII
UniProt
P43166
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CA7 Rabbit Polyclonal Antibody (orb584571) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005173
Preservative
Lyophilized powder
AA Sequence
YRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
223134-01 50 µL
GZMA (CTL tryptase, CTLA3, Cytolytic t Cell and Natural Killer Cell specific trypsin like Serine Protease, Cytotoxic T Lymphocyte Associated Serine esterase 3, Cytotoxic T Lymphocyte Proteinase 1, Cytotoxic T-Lymphocyte Proteinase 1, Fragmentin 1, Fragmentin-1, GRAA_HUMAN, Granzyme 1 cytotoxic T Lymphocyte Associated Serine esterase 3, Granzyme A (Cytotoxic T Lymphocyte Associated Serine esterase 3, Hanukah Factor Serine Protease), Granzyme A (granzyme 1, cytotoxic T Lymphocyte Associated Serine esterase 3), Granzyme A, Granzyme A Precursor, Granzyme-1, GZMA, H Factor, Hanukah Factor Serine Protease, Hanukkah Factor, HF, HFSP, TSP1, ) discontinued
Sign In for Pricing
View Details 223134-02 100 µL
GZMA (CTL tryptase, CTLA3, Cytolytic t Cell and Natural Killer Cell specific trypsin like Serine Protease, Cytotoxic T Lymphocyte Associated Serine esterase 3, Cytotoxic T Lymphocyte Proteinase 1, Cytotoxic T-Lymphocyte Proteinase 1, Fragmentin 1, Fragmentin-1, GRAA_HUMAN, Granzyme 1 cytotoxic T Lymphocyte Associated Serine esterase 3, Granzyme A (Cytotoxic T Lymphocyte Associated Serine esterase 3, Hanukah Factor Serine Protease), Granzyme A (granzyme 1, cytotoxic T Lymphocyte Associated Serine esterase 3), Granzyme A, Granzyme A Precursor, Granzyme-1, GZMA, H Factor, Hanukah Factor Serine Protease, Hanukkah Factor, HF, HFSP, TSP1, ) discontinued
Sign In for Pricing
View Details 
MBS7266176-01 48 Well
Sheep 10 kDa Heat Shock Protein, Mitochondrial (HSPE1) ELISA Kit
Sign In for Pricing
View Details