Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA7 Peptide - middle region

CA7 Peptide - middle region

Product Specifications

Product Name Alternative

CAVII

UniProt

P43166

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CA7 Rabbit Polyclonal Antibody (orb584571) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005173

Preservative

Lyophilized powder

AA Sequence

YRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHKG1 Rabbit Polyclonal Antibody (Cy3)
orb2581478 100 µg

PHKG1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Phospho-SATB1 (Ser47) Antibody Blocking Peptide
orb1505127 500 µg

Phospho-SATB1 (Ser47) Antibody Blocking Peptide

Sign In for Pricing
View Details
4-Methoxy-2-methylbenzylamine hydrochloride
FM66705-01 0.5 g

4-Methoxy-2-methylbenzylamine hydrochloride

Sign In for Pricing
View Details
4-Methoxy-2-methylbenzylamine hydrochloride
FM66705-02 1 g

4-Methoxy-2-methylbenzylamine hydrochloride

Sign In for Pricing
View Details
4-Methoxy-2-methylbenzylamine hydrochloride
FM66705-03 2 g

4-Methoxy-2-methylbenzylamine hydrochloride

Sign In for Pricing
View Details
4-Methoxy-2-methylbenzylamine hydrochloride
FM66705-04 5 g

4-Methoxy-2-methylbenzylamine hydrochloride

Sign In for Pricing
View Details