Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHA7 Peptide - C-terminal region

EPHA7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EHK3, HEK11

UniProt

Q15375

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPHA7 Rabbit Polyclonal Antibody (orb585783) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004431

Preservative

Lyophilized powder

AA Sequence

SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin light chain kinase (MYLK) Human qPCR Primer Pair (NM_053025)
HP232104 200 Reactions

Myosin light chain kinase (MYLK) Human qPCR Primer Pair (NM_053025)

Sign In for Pricing
View Details
DNL4 Antibody
8C13046-AAT 50 µg

DNL4 Antibody

Sign In for Pricing
View Details
Scx Mouse Gene Knockout Kit (CRISPR)
KN515413 1 Kit

Scx Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DNAL1 Rabbit Polyclonal Antibody
TA370721 100 µL

DNAL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ASPG (NM_001080464) Human Over-expression Lysate
LC420721 20 µg

ASPG (NM_001080464) Human Over-expression Lysate

Sign In for Pricing
View Details
PEX2 (NM_000318) Human Over-expression Lysate
LY424799 100 µg

PEX2 (NM_000318) Human Over-expression Lysate

Sign In for Pricing
View Details