Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF18 Peptide - C-terminal region

FGF18 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FGF-18, ZFGF5

UniProt

O76093

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGF18 Rabbit Polyclonal Antibody (orb585784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003853

Preservative

Lyophilized powder

AA Sequence

GKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Shigella flexneri NLPI Polyclonal Antibody
MBS7166358 Inquire

Rabbit anti-Shigella flexneri NLPI Polyclonal Antibody

Sign In for Pricing
View Details
TOMM40 Polyclonal Antibody
E-AB-65428-01 60 µL

TOMM40 Polyclonal Antibody

Sign In for Pricing
View Details
TOMM40 Polyclonal Antibody
E-AB-65428-02 120 µL

TOMM40 Polyclonal Antibody

Sign In for Pricing
View Details
TOMM40 Polyclonal Antibody
E-AB-65428-03 200 µL

TOMM40 Polyclonal Antibody

Sign In for Pricing
View Details
RBMS1 (NM_016839) Human Tagged ORF Clone Lentiviral Particle
RC221296L3V 200 µL

RBMS1 (NM_016839) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Wipf1 ORF Vector (Rat) (pORF)
ORF079144 1.0 µg DNA

Wipf1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details