Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF18 Peptide - C-terminal region

FGF18 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FGF-18, ZFGF5

UniProt

O76093

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGF18 Rabbit Polyclonal Antibody (orb585784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003853

Preservative

Lyophilized powder

AA Sequence

GKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fuchsin Basic Sodium Sulfite Broth
LA2190 250 g

Fuchsin Basic Sodium Sulfite Broth

Sign In for Pricing
View Details
TIAM1, CT (TIAM1, T-lymphoma invasion and metastasis-inducing protein 1) (MaxLight 650)
MBS6355500-01 0.1 mL

TIAM1, CT (TIAM1, T-lymphoma invasion and metastasis-inducing protein 1) (MaxLight 650)

Sign In for Pricing
View Details
TIAM1, CT (TIAM1, T-lymphoma invasion and metastasis-inducing protein 1) (MaxLight 650)
MBS6355500-02 5x 0.1 mL

TIAM1, CT (TIAM1, T-lymphoma invasion and metastasis-inducing protein 1) (MaxLight 650)

Sign In for Pricing
View Details
Human V(D)J recombination-activating protein 2 (RAG2) ELISA Kit
RK08333 96 Tests

Human V(D)J recombination-activating protein 2 (RAG2) ELISA Kit

Sign In for Pricing
View Details
Biotinylated Anti-CD38 (lumrotatug biosimilar) mAb
12-90203B-100 100 µg

Biotinylated Anti-CD38 (lumrotatug biosimilar) mAb

Sign In for Pricing
View Details
Beclin 1 Antibody Blocking peptide
MBS9220201-01 0.5 mg

Beclin 1 Antibody Blocking peptide

Sign In for Pricing
View Details