Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIMS1 Peptide - middle region

LIMS1 Peptide - middle region

Product Specifications

Product Name Alternative

PINCH, PINCH1

UniProt

B7Z7R3

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIMS1 Rabbit Polyclonal Antibody (orb585831) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001180414

Preservative

Lyophilized powder

AA Sequence

HLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rad51ap1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4901204 1.0 µg DNA

Rad51ap1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
DNAJC9 Polyclonal Antibody, PerCP Conjugated
bs-13024R-PerCP 100 µL

DNAJC9 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
1- (4-Bromo-2-fluorophenyl) -1H-pyrrole
PC1021497-01 250 mg

1- (4-Bromo-2-fluorophenyl) -1H-pyrrole

Sign In for Pricing
View Details
1- (4-Bromo-2-fluorophenyl) -1H-pyrrole
PC1021497-02 500 mg

1- (4-Bromo-2-fluorophenyl) -1H-pyrrole

Sign In for Pricing
View Details
1- (4-Bromo-2-fluorophenyl) -1H-pyrrole
PC1021497-03 1 g

1- (4-Bromo-2-fluorophenyl) -1H-pyrrole

Sign In for Pricing
View Details
C12orf67 sgRNA CRISPR Lentivector set (Human)
K0293201 3x 1.0 µg

C12orf67 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details