Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIMS1 Peptide - middle region

LIMS1 Peptide - middle region

Product Specifications

Product Name Alternative

PINCH, PINCH1

UniProt

B7Z7R3

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIMS1 Rabbit Polyclonal Antibody (orb585831) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001180414

Preservative

Lyophilized powder

AA Sequence

HLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Adenylosuccinate Lyase Antibody (OTI2D10) [mFluor Violet 450 SE]
NBP2-70101MFV450 0.1 mL

Mouse Monoclonal Adenylosuccinate Lyase Antibody (OTI2D10) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
ELL Antibody
orb1262194 400 μl

ELL Antibody

Sign In for Pricing
View Details
RPL17P42 CRISPRa sgRNA lentivector (set of three targets)(Human)
40907121 3x 1.0µg DNA

RPL17P42 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Rpo1-3 Protein Vector (Rat) (pPM-C-HA)
41996026 500 ng

Rpo1-3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Human DPH7 Protein Lysate
MBS8410698-01 0.02 mg

Human DPH7 Protein Lysate

Sign In for Pricing
View Details
Human DPH7 Protein Lysate
MBS8410698-02 5x 0.02 mg

Human DPH7 Protein Lysate

Sign In for Pricing
View Details