Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLNR Peptide - C-terminal region

MLNR Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR38, MTLR1

UniProt

O43193

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MLNR Rabbit Polyclonal Antibody (orb586228) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001498

Preservative

Lyophilized powder

AA Sequence

ASINPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPHA10 siRNA (Mouse)
orb1836453-01 15 nmol

EPHA10 siRNA (Mouse)

Sign In for Pricing
View Details
EPHA10 siRNA (Mouse)
orb1836453-02 30 nmol

EPHA10 siRNA (Mouse)

Sign In for Pricing
View Details
PLXNC1/CD232 Polyclonal Antibody, PerCP Conjugated
bs-7492R-PerCP 100 µL

PLXNC1/CD232 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Recombinant Human GDF15, Fc tagged
GDF15-204H 20 µg

Recombinant Human GDF15, Fc tagged

Sign In for Pricing
View Details
LOC100271845 Recombinant Protein (Rat)
RP208463 100 µg

LOC100271845 Recombinant Protein (Rat)

Sign In for Pricing
View Details
PLA2G12A Antibody (Center) Blocking Peptide
MBS9221873-01 0.5 mg

PLA2G12A Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details