Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLNR Peptide - C-terminal region

MLNR Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR38, MTLR1

UniProt

O43193

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MLNR Rabbit Polyclonal Antibody (orb586228) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001498

Preservative

Lyophilized powder

AA Sequence

ASINPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rp-8-Br-PET-cGMPS
MBS5757718 Inquire

Rp-8-Br-PET-cGMPS

Sign In for Pricing
View Details
Recombinant Pseudomonas fluorescens NADH-quinone oxidoreductase subunit K (nuoK)
MBS1095573 Inquire

Recombinant Pseudomonas fluorescens NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
SGSM1 Protein Lysate (Human) with C-Ha Tag
43642031 100 µg

SGSM1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Prpf19 sgRNA CRISPR Lentivector set (Mouse)
K4951301 3x 1.0 µg

Prpf19 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Mouse PCSK1 Protein, His (Fc)-Avi-tagged
PCSK1-6562M 50 µg

Recombinant Mouse PCSK1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
IKKB, phosphorylated (S733) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (FITC) discontinued
036964-FITC 200 µL

IKKB, phosphorylated (S733) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (FITC) discontinued

Sign In for Pricing
View Details