Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBS9 Peptide - N-terminal region

BBS9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B1, C18, D1, MGC118917, PTHB1

UniProt

Q3SYG4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BBS9 Rabbit Polyclonal Antibody (orb586375) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055266

Preservative

Lyophilized powder

AA Sequence

TDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyridine-Sulfur Trioxide Complex
TRC-P991560-50G 50 g

Pyridine-Sulfur Trioxide Complex

Sign In for Pricing
View Details
SKP2 (NM_005983) Human Over-expression Lysate
LC401815 20 µg

SKP2 (NM_005983) Human Over-expression Lysate

Sign In for Pricing
View Details
CD80 (B7-1) (C80/2776), CF594 conjugate, 0.1mg/mL
BNC942776-100 1x 100 µL

CD80 (B7-1) (C80/2776), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AzoDye-1 Succinimidyl Ester
2402-AAT 5 mg

AzoDye-1 Succinimidyl Ester

Sign In for Pricing
View Details
NFH (NEFH) Rabbit Polyclonal Antibody
AP20624PU-N 100 µg

NFH (NEFH) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Unc13d Mouse Gene Knockout Kit (CRISPR)
KN518703 1 Kit

Unc13d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details