Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BBS9 Peptide - N-terminal region

BBS9 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B1, C18, D1, MGC118917, PTHB1

UniProt

Q3SYG4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BBS9 Rabbit Polyclonal Antibody (orb586375) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055266

Preservative

Lyophilized powder

AA Sequence

TDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dnmt3b Rabbit Polyclonal Antibody
ER1802-55 100 µL

Dnmt3b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARHGEF1 (NM_199002) Human Recombinant Protein
TP321180 20 µg

ARHGEF1 (NM_199002) Human Recombinant Protein

Sign In for Pricing
View Details
MYLK2 (NM_033118) Human Recombinant Protein
TP313583 20 µg

MYLK2 (NM_033118) Human Recombinant Protein

Sign In for Pricing
View Details
Amdhd1 Mouse Gene Knockout Kit (CRISPR)
KN501184 1 Kit

Amdhd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TentaGel® HL Bromo Acetal
HL12019.100G 100 g

TentaGel® HL Bromo Acetal

Sign In for Pricing
View Details
ADPRH (NM_001125) Human Recombinant Protein
TP309618M 100 µg

ADPRH (NM_001125) Human Recombinant Protein

Sign In for Pricing
View Details