Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPYC Peptide - middle region

EPYC Peptide - middle region

Product Specifications

Product Name Alternative

DSPG3, PGLB, Pg-Lb, SLRR3B

UniProt

Q99645

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPYC Rabbit Polyclonal Antibody (orb326564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004941

Preservative

Lyophilized powder

AA Sequence

FYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 18 Receptor 1 (IL18R1) Polyclonal Antibody
CAU25560-01 100 µL

Interleukin 18 Receptor 1 (IL18R1) Polyclonal Antibody

Sign In for Pricing
View Details
Interleukin 18 Receptor 1 (IL18R1) Polyclonal Antibody
CAU25560-02 200 µL

Interleukin 18 Receptor 1 (IL18R1) Polyclonal Antibody

Sign In for Pricing
View Details
Interleukin 18 Receptor 1 (IL18R1) Polyclonal Antibody
CAU25560-03 1 mL

Interleukin 18 Receptor 1 (IL18R1) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GSC  (3E2)
YF-MA19903 100 ug

Anti-GSC (3E2)

Sign In for Pricing
View Details
Alpha-insect Toxin LqhaIT Polyclonal Antibody
A69815-100 100 µL

Alpha-insect Toxin LqhaIT Polyclonal Antibody

Sign In for Pricing
View Details
RPL18 Protein Lysate (Human) with C-Ha Tag
40920031 100 µg

RPL18 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details