Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPSE2 Peptide - N-terminal region

HPSE2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ11684, FLJ44022, HPA2, HPR2, MGC133234

UniProt

Q8WWQ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPSE2 Rabbit Polyclonal Antibody (orb586382) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001159717

Preservative

Lyophilized powder

AA Sequence

SPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDEPNNYRTMH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tm4sf5 Rat shRNA Lentiviral Particle (Locus ID 303256)
TL705587V 500 µL Each

Tm4sf5 Rat shRNA Lentiviral Particle (Locus ID 303256)

Sign In for Pricing
View Details
DFNB71 AAV siRNA Pooled Vector
18119161 1.0 µg

DFNB71 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
PTGES2 Mouse Monoclonal Antibody [Clone ID: LBI2C3]
AMM13154V 100 µL

PTGES2 Mouse Monoclonal Antibody [Clone ID: LBI2C3]

Sign In for Pricing
View Details
8- Methylamino- cyclic inosine diphosphate ribose (8-MA-N¹-cIDPR), sodium salt
M 063-025 5x 0.5 µmol

8- Methylamino- cyclic inosine diphosphate ribose (8-MA-N¹-cIDPR), sodium salt

Sign In for Pricing
View Details
Morinda Root Extract
C02340-5mg 5 mg

Morinda Root Extract

Sign In for Pricing
View Details
AA147
orb1219563-01 200 mg

AA147

Sign In for Pricing
View Details