Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPSE2 Peptide - N-terminal region

HPSE2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ11684, FLJ44022, HPA2, HPR2, MGC133234

UniProt

Q8WWQ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPSE2 Rabbit Polyclonal Antibody (orb586382) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001159717

Preservative

Lyophilized powder

AA Sequence

SPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDEPNNYRTMH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trypsin 1:250 for Biochemistry Porcine Gastric Mucosa
251865-01 25 g

Trypsin 1:250 for Biochemistry Porcine Gastric Mucosa

Sign In for Pricing
View Details
Trypsin 1:250 for Biochemistry Porcine Gastric Mucosa
251865-02 100 g

Trypsin 1:250 for Biochemistry Porcine Gastric Mucosa

Sign In for Pricing
View Details
Trypsin 1:250 for Biochemistry Porcine Gastric Mucosa
251865-03 500 g

Trypsin 1:250 for Biochemistry Porcine Gastric Mucosa

Sign In for Pricing
View Details
PDIA4 Rabbit pAb
E45R30032N-50 50 µL

PDIA4 Rabbit pAb

Sign In for Pricing
View Details
HEMGN Rabbit Polyclonal Antibody (HRP)
orb2101040 100 µL

HEMGN Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Kv3.2 (KCNC2) (NM_153748) Human Over-expression Lysate
E45H14950-2 20 µg

Kv3.2 (KCNC2) (NM_153748) Human Over-expression Lysate

Sign In for Pricing
View Details