Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL5B Peptide - C-terminal region

KIR2DL5B Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIR2DL5, KIR2DL5.2, KIR2DLX

UniProt

Q8NHK4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIR2DL5B Rabbit Polyclonal Antibody (orb586383) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001018091

Preservative

Lyophilized powder

AA Sequence

DQDPQEVTYAQLDHCVFTQTKITSPSQRPKAPPTDTTMYMELPNAKPRSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CDC27 (Thr244) Rabbit Polyclonal Antibody (Cy5)
orb895127 100 µL

Phospho-CDC27 (Thr244) Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
[(3R)-3-Hydroxydodecanoyl]-L-carnitine-d3 Inner Salt
TRC-H943228-25MG 25 mg

[(3R)-3-Hydroxydodecanoyl]-L-carnitine-d3 Inner Salt

Sign In for Pricing
View Details
Glycosylphosphatidylinositol Specific Phospholipase D1 Guinea Pig ELISA Kit
D8188 96 Tests

Glycosylphosphatidylinositol Specific Phospholipase D1 Guinea Pig ELISA Kit

Sign In for Pricing
View Details
RBJ (DNAJC27) (NM_016544) Human Recombinant Protein
TP305500 20 µg

RBJ (DNAJC27) (NM_016544) Human Recombinant Protein

Sign In for Pricing
View Details
IFT27 Protein Vector (Rat) (pPM-C-HA)
24290026 500 ng

IFT27 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Anti-Human PRKAR1A pAb
PA4547-01 50 μL

Rabbit Anti-Human PRKAR1A pAb

Sign In for Pricing
View Details