Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGSN Peptide - N-terminal region

LGSN Peptide - N-terminal region

Product Specifications

Product Name Alternative

GLULD1, LGS, MGC163238, MGC163240

UniProt

Q5TDP6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LGSN Rabbit Polyclonal Antibody (orb586385) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057655

Preservative

Lyophilized powder

AA Sequence

QEDSTRDEGNETEANSMNTLRRTRKKVTKPYVCSTEVGETDMSNSNDCMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CORO7 (N-term) Rabbit Polyclonal Antibody
AP51028PU-N 400 µL

CORO7 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 19 Rabbit Polyclonal Antibody
ER1803-79 100 µL

Cytokeratin 19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Bromoethyl Acetate
TRC-B750110-5G 5 g

2-Bromoethyl Acetate

Sign In for Pricing
View Details
Red Fluorescent SR101-Phe-CMK Serine Protease Assay Kit
952 100 Tests

Red Fluorescent SR101-Phe-CMK Serine Protease Assay Kit

Sign In for Pricing
View Details
Vmn1r70 Mouse Gene Knockout Kit (CRISPR)
KN519086 1 Kit

Vmn1r70 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BRIT1 (MCPH1) Rabbit Polyclonal Antibody
TA369844 100 µL

BRIT1 (MCPH1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details