Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGSN Peptide - N-terminal region

LGSN Peptide - N-terminal region

Product Specifications

Product Name Alternative

GLULD1, LGS, MGC163238, MGC163240

UniProt

Q5TDP6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LGSN Rabbit Polyclonal Antibody (orb586385) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057655

Preservative

Lyophilized powder

AA Sequence

QEDSTRDEGNETEANSMNTLRRTRKKVTKPYVCSTEVGETDMSNSNDCMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXJ1 Antibody
8C11446-AAT 50 µg

FOXJ1 Antibody

Sign In for Pricing
View Details
MYADM (NM_001020821) Human Over-expression Lysate
LC422679 20 µg

MYADM (NM_001020821) Human Over-expression Lysate

Sign In for Pricing
View Details
Serotonin N acetyltransferase (AANAT) (NM_001088) Human Over-expression Lysate
LC421333 20 µg

Serotonin N acetyltransferase (AANAT) (NM_001088) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Usp16 activation kit by CRISPRa
GA209723 1 Kit

Mouse Usp16 activation kit by CRISPRa

Sign In for Pricing
View Details
OSBP1 (OSBP) (NM_002556) Human Recombinant Protein
TP304250 20 µg

OSBP1 (OSBP) (NM_002556) Human Recombinant Protein

Sign In for Pricing
View Details
FKRP Antibody
8C11711-AAT 50 µg

FKRP Antibody

Sign In for Pricing
View Details