Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTX3 Peptide - C-terminal region

MTX3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686O1788

UniProt

Q5HYI7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTX3 Rabbit Polyclonal Antibody (orb586390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAW95840

Preservative

Lyophilized powder

AA Sequence

NRNQQQIDFGISPAGQETVDANLQKLTQLVNKESNLIEKMDDNLRQSPQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5AN1 (C-term) Rabbit Polyclonal Antibody
AP53084PU-N 400 µL

OR5AN1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(±)-Menthone
TRC-M219135-1G 1 g

(±)-Menthone

Sign In for Pricing
View Details
3,17-Di-O-acetyl Androsta-5,14,16-triene-3Beta,17-diol
TRC-D308680-25MG 25 mg

3,17-Di-O-acetyl Androsta-5,14,16-triene-3Beta,17-diol

Sign In for Pricing
View Details
Murine IL-6 ELISA Kit, 1 x 48-well (pre-coated)
EA101687 1x 48 Well (Pre-Coated)

Murine IL-6 ELISA Kit, 1 x 48-well (pre-coated)

Sign In for Pricing
View Details
Anabaseine-d4
TRC-A637152-5MG 5 mg

Anabaseine-d4

Sign In for Pricing
View Details
Usp51 Mouse Gene Knockout Kit (CRISPR)
KN518810 1 Kit

Usp51 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details