Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTX3 Peptide - C-terminal region

MTX3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686O1788

UniProt

Q5HYI7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTX3 Rabbit Polyclonal Antibody (orb586390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAW95840

Preservative

Lyophilized powder

AA Sequence

NRNQQQIDFGISPAGQETVDANLQKLTQLVNKESNLIEKMDDNLRQSPQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleophosmin (Acute Myeloid Leukemia Marker) (rNPM1/1901), CF568 conjugate, 0.1mg/mL
BNC683807-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (rNPM1/1901), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AIMP2 Rabbit Polyclonal Antibody
HA500461 100 µL

AIMP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DCAF12L2 (NM_001013628) Human Over-expression Lysate
LY422990 100 µg

DCAF12L2 (NM_001013628) Human Over-expression Lysate

Sign In for Pricing
View Details
Alpha-1-Fetoprotein Antibody
KC-1779-01 50 μL

Alpha-1-Fetoprotein Antibody

Sign In for Pricing
View Details
Alpha-1-Fetoprotein Antibody
KC-1779-02 100 µL

Alpha-1-Fetoprotein Antibody

Sign In for Pricing
View Details
Alpha-1-Fetoprotein Antibody
KC-1779-03 1 mL

Alpha-1-Fetoprotein Antibody

Sign In for Pricing
View Details