Animal-Free GRO-beta/CXCL2, Human (His)
GRO-beta/CXCL2 Protein, generated by activated monocytes and neutrophils, is prominently expressed at inflammatory sites. Notably, this chemokine, with hematoregulatory properties, suppresses hematopoietic progenitor cell proliferation in vitro. GRO-beta (5-73) displays heightened hematopoietic activity, emphasizing its significant role in regulating hematopoiesis. Animal-Free GRO-beta/CXCL2 Protein, Human (His) is the recombinant human-derived animal-FreeGRO-beta/CXCL2 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free GRO-beta/CXCL2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-gro-beta-cxcl2-protein-human-his.html
Purity
98.0
Smiles
APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Molecular Formula
2920 (Gene_ID) P19875 (A35-N107) (Accession)
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF594 conjugate, 0.1mg/mL
