Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL34 Peptide - C-terminal region

RPL34 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC111005

UniProt

P49207

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL34 Rabbit Polyclonal Antibody (orb586394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000986

Preservative

Lyophilized powder

AA Sequence

SKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR7A3 (Aflatoxin B1 Aldehyde Reductase Member 3, AFB1 Aldehyde Reductase 2, AFB1-AR 2, AFAR2)
123178 50 µg

AKR7A3 (Aflatoxin B1 Aldehyde Reductase Member 3, AFB1 Aldehyde Reductase 2, AFB1-AR 2, AFAR2)

Sign In for Pricing
View Details
PLA2G7 Peptide - middle region
orb1997998 100 µg

PLA2G7 Peptide - middle region

Sign In for Pricing
View Details
Anti-PNP Antibody Picoband® (monoclonal, 7G5) (Biotine Conjugate)
M00988-Biotin 100 µg/Vial

Anti-PNP Antibody Picoband® (monoclonal, 7G5) (Biotine Conjugate)

Sign In for Pricing
View Details
Follicle Stimulating Hormone, beta (FSH) (MaxLight 550)
MBS6264560-01 0.1 mL

Follicle Stimulating Hormone, beta (FSH) (MaxLight 550)

Sign In for Pricing
View Details
Follicle Stimulating Hormone, beta (FSH) (MaxLight 550)
MBS6264560-02 5x 0.1 mL

Follicle Stimulating Hormone, beta (FSH) (MaxLight 550)

Sign In for Pricing
View Details
GFPT2 Protein Vector (Mouse) (pPB-N-His)
PV181779 500 ng

GFPT2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details