Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL34 Peptide - C-terminal region

RPL34 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC111005

UniProt

P49207

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL34 Rabbit Polyclonal Antibody (orb586394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000986

Preservative

Lyophilized powder

AA Sequence

SKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLGA6L1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2772407 1.0 µg DNA

GOLGA6L1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ICOS rabbit pAb
ES8392-01 50 µL

ICOS rabbit pAb

Sign In for Pricing
View Details
ICOS rabbit pAb
ES8392-02 100 µL

ICOS rabbit pAb

Sign In for Pricing
View Details
NDUFA4 sgRNA CRISPR Lentivector (Human) (Target 1)
K1408302 1.0 µg DNA

NDUFA4 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
SLC22A25 Rabbit Polyclonal Antibody (Fluoro488)
orb3129811 100 µg

SLC22A25 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Rabbit Polyclonal Cytokeratin 12 Antibody [mFluor Violet 500 SE]
NBP2-99151MFV500 0.1 mL

Rabbit Polyclonal Cytokeratin 12 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details