Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBPL2 Peptide - N-terminal region

TBPL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TBP2, TRF3

UniProt

Q6SJ96

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBPL2 Rabbit Polyclonal Antibody (orb586397) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAW80675

Preservative

Lyophilized powder

AA Sequence

SGDFSSVDLSFLPDEVTQENKDQPVISKHETEENSESQSPQSRLPSPSEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF594 conjugate, 0.1mg/mL
BNC942428-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caspase-6 Antibody
F43295-0.08ML 0.08 mL

Caspase-6 Antibody

Sign In for Pricing
View Details
PCGF6 (NM_001011663) Human Over-expression Lysate
LC423286 20 µg

PCGF6 (NM_001011663) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF3 antibody
FNab09682 100 µg

ZNF3 antibody

Sign In for Pricing
View Details
p-Coumaroylagmatine-D₈
TRC-C979471-10MG 10 mg

p-Coumaroylagmatine-D₈

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Rat CD45 Antibody[OX-1]
E-AB-F1227G-01 50 Tests

PE/Cyanine5 Anti-Rat CD45 Antibody[OX-1]

Sign In for Pricing
View Details